PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G472000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 247aa    MW: 28497.2 Da    PI: 8.1947
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G472000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65.3e-171057148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT++Ed++lv  v ++G ++W+ Ia+  g++Rt+k+c++rw +yl
  Aqcoe1G472000.1.p 10 KGPWTEQEDLQLVYFVSLFGERRWDFIAKVSGLNRTGKSCRLRWVNYL 57
                       79********************************************97 PP

2Myb_DNA-binding54.72.3e-1763108148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        rgr+T++E+ l ++++ ++G++ W++Iar+++ gRt++++k++w++++
  Aqcoe1G472000.1.p  63 RGRMTPQEERLVLELHSRWGNR-WSRIARKLP-GRTDNEIKNYWRTHM 108
                        89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.195557IPR017930Myb domain
SMARTSM007179.4E-16959IPR001005SANT/Myb domain
SuperFamilySSF466891.33E-299104IPR009057Homeodomain-like
PfamPF002492.9E-151057IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-201164IPR009057Homeodomain-like
CDDcd001679.99E-111257No hitNo description
PROSITE profilePS5129426.39158112IPR017930Myb domain
SMARTSM007172.3E-1662110IPR001005SANT/Myb domain
PfamPF002492.3E-1563107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2365111IPR009057Homeodomain-like
CDDcd001677.70E-1165108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MKMVQEETRK GPWTEQEDLQ LVYFVSLFGE RRWDFIAKVS GLNRTGKSCR LRWVNYLHPG  60
LKRGRMTPQE ERLVLELHSR WGNRWSRIAR KLPGRTDNEI KNYWRTHMRK KAQERKRALS  120
LSSSSCCSTS PNKNIPMDLS SKAKIEEGSS SSDFKDVKGK MTEEEGVKGY PMDRIWDEIA  180
SSEEVSSGLG YEGGTEEGSS FTCPPLASPL WDYCFDSLWR MDEEEIKMLV PFSDLSAYNY  240
GHSREL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C4e-29211250159MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-29211250159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00600PBMTransfer from AT5G59780Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010260061.11e-110PREDICTED: transcription factor MYB59-like isoform X3
SwissprotQ4JL843e-87MYB59_ARATH; Transcription factor MYB59
TrEMBLF6GV451e-106F6GV45_VITVI; Putative uncharacterized protein
STRINGVIT_06s0004g04140.t011e-106(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.32e-87myb domain protein 59